PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA08G0023800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 340aa    MW: 37834.8 Da    PI: 11.9843
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA08G0023800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-14108152347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+  ++ + ++lG+g+W+ I++ + ++Rt+ q+ s+ qky
  ORGLA08G0023800.1 108 PWTEEEHRTFLAGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKY 152
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.431101157IPR017930Myb domain
SuperFamilySSF466891.08E-17102157IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-18104156IPR006447Myb domain, plants
SMARTSM007173.5E-11105155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-12108151IPR009057Homeodomain-like
PfamPF002494.9E-12108152IPR001005SANT/Myb domain
CDDcd001677.64E-10108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
CLKIRAPPRC ASSASPSRRR RRRSRSRSRS RIRPTPGIRA RGRRGEEAMR KCKSMGNLAA  60
XXXXXXXXXX XXXXXXXXXX XXXXXSDGGL LLSSGKRRRA QERKKAVPWT EEEHRTFLAG  120
LEKLGKGDWR GISKNFVTTR TPTQVASHAQ KYFLRQTNPN KKKRRSSLFD MMATDMSPXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXEGV SSSSTVNLAP QVARDLPPPI PSFKATNVDS  240
SLSKMNHMDG FLRAPMLFRP IPRIAEGASS STPATASIAD LEFQANLTAC SNALFASPRR  300
KPKKADPPAE KDLDLTVAPP SQQNRASISS QNAVGVIQVV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11724RRRRRRSR
22232RSRSRSRSRIR
32432RSRSRSRIR
4160164KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1063310.0AK106331.1 Oryza sativa Japonica Group cDNA clone:002-101-F07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648291.11e-157PREDICTED: uncharacterized protein LOC4344664 isoform X1
TrEMBLI1QFN70.0I1QFN7_ORYGL; Uncharacterized protein
STRINGORGLA08G0023800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58583652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.17e-37MYB_related family protein